Porphyromonas gingivalis antigens for the diagnosis and treatment of periodontitis
CA 2249746 C · Owner: Reynolds, Eric Charles · Inventors: Hendtlass, Anne; Slakeski, Nada; Reynolds, Eric Charles
Overview
Its claims, description and drawings are in the Canadian Patents Database.
Open the CIPO recordAbstract From the Canadian patent
The present invention provides a composition for use in raising an immune response directed against Porphyromonas gingivalis. The composition includes a suitable adjuvant and/or acceptable carrier and one substantially purified P. gingivalis immunogen. The immunogen is selected from the group consisting of Antigen 1 Antigen 2, Antigen 3, Antigen , 4 and epitope containing fragments thereof in which: Antigen , 1 is an antigen of P. gingivalis and has an internal amino acid sequence: DLENKGEATLLVTFGSSYKAPRETYAKIEKTFAAAYPDQR; Antigen 2 is an antigen of P. gingivalis and has an internal amino acid sequence: DNPDENPLEGDITQTHTEKYVLAED; Antigen 3 is an antigen of P. gingivalis and has an …
Read the whole patent
Listed from its CIPO record in Patent Yard's archive of Canadian patents past their term. Its claims, description and drawings are in the CIPO record and on Google Patents, and the Claude kit works from them.
Why it's free to use
- Filed April 1, 1997 and granted June 12, 2012. A Canadian patent filed from October 1, 1989 lasts 20 years from filing, so its term ended April 1, 2017.
- A certificate of supplementary protection adds at most two years for a drug, so even that would have ended by April 1, 2019.
- We check Canadian rights only. A patent in its family in another country could still be in force: check its family on Google Patents.
Timeline
Timeline From CIPO dates
Sources & verification
Official CIPO records
Everything on this page comes from the CIPO record linked above. Contains information licensed under the Open Government Licence – Canada.